Secondary Antibodies

General description Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of

Immunogen Synthetic peptide directed towards the C terminal region of human ACVR2B Application Anti-ACVR2B antibody produced in rabbit is suitable for western blotting at a concentration of 0.25&#956g/ml.

Immunogen Recombinant protein corresponding to activin A receptor type 2B Sequence ECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPP Application All Prestige Antibodies Powered by Atlas

General description Activin receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I

Immunogen acylphosphatase 2, muscle type recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen ADAM metallopeptidase domain 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen ADAM metallopeptidase domain 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

ADAM12 (metallopeptidase domain 12) gene is mapped in human chromosome 10q26.2.

Immunogen Synthetic peptide directed towards the middle region of human ADAM2 Biochem/physiol Actions ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins

The gene ADAM2 (disintegrin and metalloproteinase domain-containing protein 2) is mapped to human chromosome 8p11. It belongs to the ADAM family of proteins.

The gene ADAM2 (disintegrin and metalloproteinase domain-containing protein 2) is mapped to human chromosome 8p11. It belongs to the ADAM family of proteins.

Specificity Recognizes mouse fertilin beta by immunoblot, staining of bands in a 46-48 kDa range (multiple bands are due to variable protein glycosylation). Immunogen Recombinant mouse fertilin produced by baculovirus expressin in SF9 cells.