Secondary Antibodies

Immunogen poly(A) binding protein interacting protein 2B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen poly(A) binding protein interacting protein 2B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen partner and localizer of BRCA2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen paralemmin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Pantothenate kinase 2 (PANK2) is localized to the mitochondria. The gene encoding the enzyme is present on chromosome 20.

Immunogen 3&#8242-phosphoadenosine 5&#8242-phosphosulfate synthase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen 3&#8242-phosphoadenosine 5&#8242-phosphosulfate synthase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Recombinant protein corresponding to parkin RBR E3 ubiquitin protein ligase Sequence LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECS Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen paired box 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen paired box 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Synthetic peptide directed towards the N terminal region of human PAX6 Biochem/physiol Actions PAX6 is one of many human homologues of the Drosophila melanogaster gene prd. In addition to the hallmark feature of this gene family, a

Immunogen Synthetic peptide directed towards the C-terminal region of PAX7 Biochem/physiol Actions PAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an