Secondary Antibodies

Mothers against decapentaplegic homolog 2 (UniProt Q15796 also known as hMAD-2, hSMAD2, JV18-1, MAD homolog 2, Mad-related protein 2, Mothers against DPP homolog 2, SMAD 2, SMAD family member 2, Smad2) is encoded by the SMAD2 (also known as MADH2,

BRCA2 (Breast Cancer Type 2 susceptibility protein) is a tumor suppressor protein encoded by the BRCA2 gene. The protein encoded by this gene plays a direct role in error-free double-strand break repair and homologous recombination.

This microplate is a superior combination of optimal clarity, thermal stability, biocompatibility, low auto-fluorescence, flatness and chemical resistance making it ideal for use in SMC &#174 immunoassays for the SMCxPRO &#174 instrument. Part

Extracellular Signal-Regulated Kinases (ERKs) are members of mitogen-activated protein kinase superfamily (MAPK). MAPK cascade is an evolutionary conserved module that mediates the signaling from various extracellular stimuli to the nucleus.

H2AX comprises 2-25% of the total H2A complement in human cells, whereas in the budding yeast it constitutes virtually all of the H2A molecules. It has N-terminal and C-terminal region with a central globular domain.

Specificity Integrin B1 phosphorylated on Ser785 Immunogen C-terminal Peptide Application Detect phospho-Integrin &#9461 (Ser785) using this Anti-phospho-Integrin &#9461 (Ser785) Antibody validated for use in WB. Research Category Cell Structure

Keratin, type II cytoskeletal 8 (UniProt P05787 also known as CK-8, Cytokeratin-8, K8, Keratin-8, Type-II keratin Kb8) is encoded by the KRT8 (also known as CYK8) gene (Gene ID 3856) in human. Cytokeratin-8 (Keratin-8 or K8) belongs to a family of

Specificity Synapsin I, phospho Serine 62,67. The antibody recognizes a protein doublet of ~78 kDa corresponding to Synapsin I, phospho Serine 62,67 in lysates from rat cortex.

TIE2 (tyrosine kinase with Ig and EGF homology domains 2) is expressed almost exclusively in endothelial cells in mice, rats and humans. This receptor possesses a unique extracellular domain containing two immunoglobulin-like loops separated by

Paired mesoderm homeobox protein 2B (PHOX2B), also known as Neuroblastoma Phox (NBPhox), PHOX2B homeodomain protein, and Paired-like homeobox 2B is a paired-homeodomain transcription factor that maintains the noradrenergic phenotype during

Immunogen paired-like homeobox 2b Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to paired like homeobox 2b Sequence MEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTLRDHQS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by