-
HPA013397-100ULImmunogen Phospholipase D2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the
-
HPA075014-100ULImmunogen Recombinant protein corresponding to pleckstrin homology domain containing B2 Sequence YGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGM Application All Prestige Antibodies Powered by Atlas Antibodies are developed and
-
HPA017973-100UL
Sigma-Aldrich
Anti-PLEKHG2 antibody produced in rabbit (C15-1448-872)
Price: $879.43List Price: $977.14Pleckstrin homology domain containing family G member 2 (PLEKHG2) is a guanine nucleotide exchange factor for GTPases like Rac and Cdc42. It belongs to the Dbl family. -
HPA048054-100UL
Sigma-Aldrich
Anti-PLEKHG2 antibody produced in rabbit (C15-1459-417)
Price: $928.29List Price: $1,031.43Immunogen pleckstrin homology domain containing, family G (with RhoGef domain) member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
AB9602Specificity Plexin-A1. The immunogen sequence has low homology with other plexin family members.
-
HPA016607-100ULImmunogen perilipin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The
-
HPA030326-100UL
Sigma-Aldrich
Anti-PM20D2 antibody produced in rabbit (C15-1452-651)
Price: $879.43List Price: $977.14Immunogen peptidase M20 domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA030327-100UL
Sigma-Aldrich
Anti-PM20D2 antibody produced in rabbit (C15-1452-652)
Price: $879.43List Price: $977.14Immunogen peptidase M20 domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA040852-100UL
Sigma-Aldrich
Anti-PMM2 antibody produced in rabbit (C15-1456-393)
Price: $928.29List Price: $1,031.43Immunogen phosphomannomutase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA063649-100UL
Sigma-Aldrich
Anti-PMM2 antibody produced in rabbit (C15-1464-433)
Price: $928.29List Price: $1,031.43Immunogen phosphomannomutase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA066490-100UL
Sigma-Aldrich
Anti-PMS2 antibody produced in rabbit (C15-1465-092)
Price: $928.29List Price: $1,031.43Immunogen PMS1 homolog 2, mismatch repair system component Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA070310-100UL
Sigma-Aldrich
Anti-PMS2 antibody produced in rabbit (C15-1465-822)
Price: $928.29List Price: $1,031.43Immunogen PMS1 homolog 2, mismatch repair system component Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive