-
HPA043809-100UL
Sigma-Aldrich
Anti-POM121 antibody produced in rabbit (C15-1457-882)
Price: $928.29List Price: $1,031.43Immunogen POM121 transmembrane nucleoporin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA049817-100UL
Sigma-Aldrich
Anti-POM121 antibody produced in rabbit (C15-1460-077)
Price: $928.29List Price: $1,031.43Immunogen POM121 transmembrane nucleoporin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA027836-100ULImmunogen POM121 membrane glycoprotein-like 12 (rat) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA046150-100ULImmunogen POM121 membrane glycoprotein-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
-
HPA003663-100ULImmunogen Protein O-mannosyl-transferase 2 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Western Blotting (1
-
HPA029193-100ULImmunogen paraoxonase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the
-
HPA024255-100ULImmunogen Popeye domain-containing protein 2 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
-
HPA058559-100UL
Sigma-Aldrich
Anti-POU2F1 antibody produced in rabbit (C15-1462-987)
Price: $928.29List Price: $1,031.43Immunogen POU class 2 homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA064323-100UL
Sigma-Aldrich
Anti-POU2F1 antibody produced in rabbit (C15-1464-609)
Price: $928.29List Price: $1,031.43Immunogen POU class 2 homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA049056-100UL
Sigma-Aldrich
Anti-POU2F2 antibody produced in rabbit (C15-1459-802)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to POU class 2 homeobox 2 Sequence PAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQAVTRPTLPDPHLSHPQPPKCLEPPSH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
HPA062096-100UL
Sigma-Aldrich
Anti-POU2F2 antibody produced in rabbit (C15-1463-987)
Price: $928.29List Price: $1,031.43Immunogen POU class 2 homeobox 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA064404-100UL
Sigma-Aldrich
Anti-POU2F2 antibody produced in rabbit (C15-1464-624)
Price: $928.29List Price: $1,031.43Immunogen POU class 2 homeobox 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the