-
Add to Cart The item has been addedHPA059377-100ULImmunogen ADAM metallopeptidase domain 20 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA035973-100ULImmunogen ADAM metallopeptidase with thrombospondin type 1 motif, 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA075079-100ULImmunogen Recombinant protein corresponding to ADAM metallopeptidase with thrombospondin type 1 motif 12 Sequence SYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETK Application All Prestige Antibodies Powered -
Add to Cart The item has been addedHPA028444-100ULImmunogen ADAM metallopeptidase with thrombospondin type 1 motif, 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA028363-100ULSigma Aldrich
ANTI-ADAMTS2 ANTIBODY PRODUCED IN RABBIT (C15-1451-795)
Price: $1,066.53List Price: $1,185.03Immunogen ADAM metallopeptidase with thrombospondin type 1 motif 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA045634-100ULSigma Aldrich
ANTI-ADAMTSL2 ANTIBODY PRODUCED IN RABBIT (C15-1458-591)
Price: $1,013.20List Price: $1,125.78Immunogen ADAMTS-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA053812-100ULSigma Aldrich
ANTI-ADAMTSL2 ANTIBODY PRODUCED IN RABBIT (C15-1461-463)
Price: $1,013.20List Price: $1,125.78Immunogen ADAMTS-like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA035479-100ULImmunogen adenosine deaminase, tRNA-specific 2, TAD2 homolog ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedSAB1401938-100UGSigma Aldrich
ANTI-ADCK2 ANTIBODY PRODUCED IN RABBIT (C15-1753-320)
Price: $980.46List Price: $1,089.40Immunogen ADCK2 (NP_443085.2, 1 a. -
Add to Cart The item has been addedSAB1300488-100UGGeneral description ADCK2 is member of the AarF domain containing kinase family. Immunogen ADCK2 (NP_443085, 588-628) This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region -
Add to Cart The item has been addedHPA036036-100ULThe gene ADCK2 (uncharacterized aarF domain-containing protein kinase 2) is mapped to human chromosome 7q34. It associates with the molecules of CoQ10 (coenzyme Q10) biosynthesis pathway. -
Add to Cart The item has been addedSAB1300489-100UGGeneral description ADCK2 is member of the AarF domain containing kinase family. Immunogen ADCK2 (NP_443085, 45-81) This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the central region of
