Secondary Antibodies

Rab3-interacting molecules (RIMs) are synaptic proteins necessary for neuronal transmission and plasticity. RIM 1 and RIM 2 proteins are expressed in overlapping but distinct patterns throughout the brain.

Immunogen RIMS binding protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen regulating synaptic membrane exocytosis 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ribonuclease, RNase A family, 12 (non-active) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen ribonuclease H2, subunit C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Ribonuclease T2, also known as Ribonuclease 6, and encoded by the gene name RNASET2 or RNASE6PL, is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated

Immunogen ribonuclease T2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen ribonuclease T2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Recombinant protein corresponding to Rho family GTPase 2 Sequence GCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen ring finger protein 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen RING finger protein 112 (Zinc finger protein 179) (Brain finger protein) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported