Secondary Antibodies

Immunogen SHC-transforming protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen shisa family member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen shisa homolog 4 (Xenopus laevis) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen shisa family member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen shisa homolog 7 (Xenopus laevis) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Synthetic peptide directed towards the C terminal region of human SHMT2 Application Anti-SHMT2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5&#956g/ml and for immunohistochemistry at a

Immunogen Synthetic peptide directed towards the N terminal region of human SHMT2 Application Anti-SHMT2 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 2.5&#956g/ml and for immunohistochemistry at a

Serine hydroxymethyltransferase 2 (SHMT2) is a mitochondrial enzyme and the gene encoding it is localized to human chromosome 12. Immunogen Serine hydroxymethyltransferase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)

Serine hydroxymethyltransferase 2 (SHMT2) is a mitochondrial enzyme and the gene encoding it is localized to human chromosome 12. Immunogen Serine hydroxymethyltransferase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)

Immunogen shroom family member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Recombinant protein corresponding to shroom family member 2 Sequence SPRHHLPQPEGPPDARETGRCYPLDKGAEGCSAGAQEPPRASRAEKASQRLAASITWADGESSRICPQETPLLHSLTQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Seven in absentia homolog 1 (Drosophila) (SIAH1) is an E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. SIAH1 has an overlapping function with SIAH2.