-
Add to Cart The item has been addedHPA071309-100ULImmunogen structural maintenance of chromosomes 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA014366-100ULImmunogen Uncharacterized protein C12orf70 recombinant protein epitope signature tag (PrEST). Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA029350-100ULImmunogen Smg-7 homolog, nonsense mediated mRNA decay factor (C. elegans) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA065331-100ULImmunogen small integral membrane protein 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA026891-100ULSigma-Aldrich
Anti-SMIM2 antibody produced in rabbit (C15-1451-255)
Price: $879.43List Price: $977.14Immunogen Putative transmembrane protein MGC5590 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA077071-100ULSigma-Aldrich
ANTI-SMIM2 ANTIBODY PRODUCED IN RABBIT (C15-1466-985)
Price: $977.14List Price: $1,085.71Immunogen small integral membrane protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA043127-100ULImmunogen chromosome 19 open reading frame 42 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA018125-100ULSphingomyelin phosphodiesterase 2 (SMPD2) is present in the endoplasmic reticulum and Golgi apparatus. Immunogen Sphingomyelin phosphodiesterase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by -
Add to Cart The item has been addedHPA029023-100ULImmunogen SET and MYND domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA049843-100ULSigma-Aldrich
Anti-SNAPC2 antibody produced in rabbit (C15-1460-091)
Price: $928.29List Price: $1,031.43Immunogen small nuclear RNA activating complex, polypeptide 2, 45kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA077597-100ULSigma-Aldrich
Anti-SNAPC2 antibody produced in rabbit (C15-1467-058)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to small nuclear RNA activating complex polypeptide 2 Sequence APSSAPRTPDPAPEKPSESSAGPSTEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVL Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA046974-100ULImmunogen SNAP-associated protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
