-
HPA062254-100UL
Sigma-Aldrich
Anti-TLX2 antibody produced in rabbit (C15-1464-033)
Price: $928.29List Price: $1,031.43Immunogen T-cell leukemia homeobox 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA046058-100UL
Sigma-Aldrich
Anti-TM2D1 antibody produced in rabbit (C15-1458-711)
Price: $928.29List Price: $1,031.43Immunogen TM2 domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA055621-100UL
Sigma-Aldrich
Anti-TM2D1 antibody produced in rabbit (C15-1462-072)
Price: $928.29List Price: $1,031.43Immunogen TM2 domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA047152-100UL
Sigma-Aldrich
Anti-TM2D2 antibody produced in rabbit (C15-1459-149)
Price: $928.29List Price: $1,031.43Immunogen TM2 domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA050547-100UL
Sigma-Aldrich
Anti-TM2D2 antibody produced in rabbit (C15-1460-340)
Price: $928.29List Price: $1,031.43Immunogen TM2 domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA054064-100ULImmunogen TM2 domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
-
HPA047397-100ULImmunogen translation machinery associated 7 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA046350-100ULImmunogen transmembrane channel-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA014254-100ULThe gene TMCC2 (transmembrane and coiled-coil domain family 2) encodes a protein that has been found to interact with an amyloid protein precursor and apolipoprotein E. The exact function of this protein is yet to be characterized.
-
HPA062862-100ULImmunogen Recombinant protein corresponding to transmembrane protein 123 Sequence ANIENSGLPHNSSANSTETLQHVPSDHTNETSNSTVKPPTSVASDSSNTTVTTMKPTA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human
-
HPA015796-100ULImmunogen Transmembrane protein 125 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA039894-100UL
Sigma-Aldrich
Anti-TMEM72 antibody produced in rabbit (C15-1455-949)
Price: $928.29List Price: $1,031.43Immunogen transmembrane protein 72 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported