Secondary Antibodies

Immunogen alpha-2-macroglobulin-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen ATP-binding cassette, sub-family A (ABC1), member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen ATP-binding cassette, sub-family C (CFTR/MRP), member 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen ATP binding cassette subfamily C member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to ABL proto-oncogene 2, non-receptor tyrosine kinase Sequence SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSF Application All Prestige Antibodies Powered

Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2) is an adaptor protein for cullin 3 which is an E3-ubiquitin ligase scaffold protein. Immunogen Ankyrin repeat and BTB/POZ domain-containing protein 2 recombinant protein epitope

Immunogen ankyrin repeat and BTB (POZ) domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ArfGAP with coiled-coil, ankyrin repeat and PH domains 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen ArfGAP with coiled-coil, ankyrin repeat and PH domains 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Acyl-coenzyme A:cholesterol acyltransferase 2 (ACAT-2), also known as Sterol O-acyltransferase 2 (SOAT2), is a synthetic enzyme that is important in lipoprotein assembly, steroid metabolism, and dietary cholesterol metabolism and absorption. ACAT-2

ACAT2 is an acyl-coenzyme A cholesterol acyltransferase that regulates the esterification of cholesterol in cells. ACAT2 has been recommended as a treatment target for hypercholesterolemia and atherosclerosis.

ACAT2 is an acyl-coenzyme A cholesterol acyltransferase that regulates the esterification of cholesterol in cells. ACAT2 has been recommended as a treatment target for hypercholesterolemia and atherosclerosis.