Secondary Antibodies

Immunogen angiotensin I converting enzyme 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Albumin, the major protein produced by liver cells, represents more than half of the total protein content of human serum. Many other body fluids also contain albumin.

Albumin, the major protein produced by liver cells, represents more than half of the total protein content of human serum. Many other body fluids also contain albumin.

Monoclonal Anti-Albumin (mouse IgG2a isotype) is derived from the HSA-11 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from immunized BALB/c mice. Albumin, the major protein produced by the liver, represents more than half

Monoclonal Anti-Albumin (mouse IgG2a isotype) is derived from the HSA-11 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from immunized BALB/c mice. Albumin, the major protein produced by the liver, represents more than half

Monoclonal Anti-Annexin V (mouse IgG1 isotype) is derived from the hybridoma AN5 produced by the fusion of mouse myeloma cells (NS1 cells) and splenocytes from BALB/c mice immunized with purified human Annexin V. Annexin V belongs to a class of Ca

Monoclonal Anti-Annexin V (mouse IgG1 isotype) is derived from the hybridoma AN5 produced by the fusion of mouse myeloma cells (NS1 cells) and splenocytes from BALB/c mice immunized with purified human Annexin V. Annexin V belongs to a class of Ca

Adaptor protein-2 (AP2) is a key constituent of clathrin-coated vesicles that mediates the endocytosis of cell membrane components such as G protein-coupled receptors (GPCRs). AP2 is a heterotetramer that consists of &#945, &#946, &#956 and

Monoclonal Anti-ASPP2 (mouse IgG1 isotype) is derived from the hybridoma DX 54.10 produced by the fusion of mouse myeloma cells (SP2/0 cells) and splenocytes from BALB/c mice.

Immunogen ATPase family, AAA domain containing 2 recombinant protein epitope signature tag (PrEST) Sequence TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK Epitope Binds to an

Immunogen Recombinant protein corresponding to Auts2, activator of transcription and developmental regulator Sequence GISPLPGGERFPYPSFHWD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen Recombinant protein corresponding to Auts2, activator of transcription and developmental regulator Sequence GISPLPGGERFPYPSFHWD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human