Secondary Antibodies

Solute carrier family 22 member 2 (SLC22A2) also known as organic cation transporter 2 (OCT2), is expressed prominently in the basolateral membrane of epithelial cells of kidney, especially in the proximal renal tubule. SLC22A2 possess 12

Immunogen solute carrier family 22 (organic cation transporter), member 2, recombinant protein epitope signature tag (PrEST) Sequence ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR Epitope Binds to an epitope located within the

Immunogen Recombinant protein corresponding to Smad family member 2 Sequence PNTIDQWDTTGLYSFSEQT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen SRY (sex determining region Y)-box 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Sex determining region Y box 9 (Sox9) is a transcription protein, that belongs to the high-mobility-group box class DNA-binding proteins. It is located on human chromosome 17q24.

Immunogen synovial sarcoma, X breakpoint 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Recombinant protein corresponding to Tet methylcytosine dioxygenase 2 Sequence PDQGGSHTQTPPQKDTQKH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen tryptophan hydroxylase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen solute carrier family 17 member 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen solute carrier family 17 member 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunoglobulin G (IgG), is one of the most abundant proteins in human serum with normal levels between 8-17 mg/mL in adult blood. IgG is important for our defense against microorganisms and the molecules are produced by B lymphocytes as a part of

HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: E, WB APPLICATIONS: NALP2 antibody can be used for detection of NALP2 by Western blot at 1 to 2 &#956g/mL. Antibody validated: Western Blot in human samples.