Secondary Antibodies

The gene CARD14 (caspase recruitment domain family member 14) encodes a member of the MAGUK (membrane-associated guanylate kinase) family of proteins. These proteins are scaffold proteins that participate in the assembly of multiprotein complexes

Immunogen cysteinyl-tRNA synthetase 2, mitochondrial (putative) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Casein Kinase 2 (CK2) is a ubiquitously expressed serine/threonine kinase that has been implicated in various cellular functions such as cell death, cell cycle regulation, and mRNA synthesis. This protein kinase comprises of two catalytic &#945

Immunogen Recombinant protein corresponding to CASK interacting protein 2 Sequence GHIHESQRGTDRIGYFPPGIVEVVSKRVGIPAARLPSAPTPLRPGFSRTPQPPAEEPPHPLTYSQLPRVGLSPDSPAGDRNSV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen caspase 2, apoptosis-related cysteine peptidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

CASPR2 (Contactin-associated protein-like 2) belongs to CASPR family and neurexin superfamily. Immunogen peptide corresponding to amino acids residues 1315-1331 of human Caspr2.

Contactin-associated protein-like 2 (UniProt Q9UHC6 also known as Cell recognition molecule Caspr2) is encoded by the CNTNAP2 (also known as AUTS15, CASPR2, CDFE, KIAA0868) gene (Gene ID 26047) in human. Caspr2 is a neurexin superfamily member

Calsequestrin 2 (CASQ2) is a calcium storage protein in the sarcoplasmic reticulum. It consists of 399 amino acids and the gene encoding it is localized on human chromosome 1p13.

Immunogen calsequestrin 2 (cardiac muscle) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Synthetic peptide directed towards the C terminal region of human CATSPER2 Biochem/physiol Actions Calcium ions play a primary role in the regulation of sperm motility. This gene belongs to a family of putative cation channels that are

Coiled-coil and C2 domain containing 1A (CC2D1A) gene codes for a signaling scaffold, which has multiple functions. It is also called Freud-1 (Five prime REpressor Under Dual repression binding protein 1), and belongs to CC2D1A gene family, which

Immunogen coiled-coil and C2 domain containing 1B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a