Secondary Antibodies

Immunogen Synthetic peptide directed towards the C terminal of human ACTN2 Biochem/physiol Actions The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin

&#945-actinin-2 (ACTN2) is present in the Z-discs of sarcomeres in skeletal muscles. It contains an amino-terminal region of 252 amino acids, a central region which has four spectrin-like motifs and the carboxyl terminus that contains a

Immunogen Synthetic peptide directed towards the N terminal region of human ACTN4 Biochem/physiol Actions Alpha actinins belong to the spectrin superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta

ACTRT2 (actin related protein T2) gene is localized to human chromosome 1p36. It is localized to the sperm head area called calyx, and forms a constituent of the cytoskeletal structure.

The gene ACTRT2 (actin related protein T2) is mapped to human chromosome 1p36.32.

Immunogen Synthetic peptide directed towards the C terminal region of human ACVR2B Application Anti-ACVR2B antibody produced in rabbit is suitable for western blotting at a concentration of 0.25&#956g/ml.

Immunogen Recombinant protein corresponding to activin A receptor type 2B Sequence ECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPP Application All Prestige Antibodies Powered by Atlas

Immunogen acylphosphatase 2, muscle type recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen ADAM metallopeptidase domain 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

ADAM12 (metallopeptidase domain 12) gene is mapped in human chromosome 10q26.2.

Immunogen ADAM metallopeptidase domain 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Synthetic peptide directed towards the middle region of human ADAM2 Biochem/physiol Actions ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins