-
HPA013970-100UL
Sigma-Aldrich
Anti-CYP2C8 antibody produced in rabbit (C15-1448-044)
Price: $879.43List Price: $977.14The gene CYP2C8 (cytochrome P450 family 2 subfamily C member 8) encodes a protein belonging to the cytochrome P450 superfamily of enzymes. It is predominantly expressed in the liver and kidney. -
HPA015066-100ULCYP2C19 (cytochrome P450, family 2, subfamily C, polypeptide 19) is a member of the cytochrome P450 enzyme family. It is an essential enzyme of phase I metabolism, and is highly expressed in smooth muscle and endothelial cells.
-
AV41675-100UL
Sigma-Aldrich
Anti-CYP2D6 antibody produced in rabbit (C15-1341-342)
Price: $593.14List Price: $659.05Anti-CγP2D6 polyclonal antibody reacts with pig, rabbit, human, mouse, rat, and zebrafish cytochrome P450, family 2, subfamily D, polypeptide 6 proteins. Cytochrome P450, family 2, subfamily D, polypeptide 6 (CγP2D6) is an important -
HPA045223-100UL
Sigma-Aldrich
Anti-CYP2D6 antibody produced in rabbit (C15-1458-456)
Price: $928.29List Price: $1,031.43Immunogen cytochrome P450, family 2, subfamily D, polypeptide 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA009128-100UL
Sigma-Aldrich
Anti-CYP2E1 antibody produced in rabbit (C15-1447-297)
Price: $977.14List Price: $1,085.71The CYP2E1 (cytochrome P450 2E1) gene is mapped to human chromosome 10 and is polymorphic. CYP2E1 is part of the cytochrome P450 (CYP) family of enzymes. -
HPA029564-100UL
Sigma-Aldrich
Anti-CYP2E1 antibody produced in rabbit (C15-1452-318)
Price: $879.43List Price: $977.14The gene CYP2E1 (cytochrome P450 2E1) is mapped to human chromosome 10. The CYP2E1 gene is polymorphic. -
HPA042949-100ULImmunogen cytochrome P450, family 2, subfamily R, polypeptide 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project
-
HPA049227-100UL
Sigma-Aldrich
Anti-CYP2S1 antibody produced in rabbit (C15-1459-867)
Price: $928.29List Price: $1,031.43Immunogen cytochrome P450, family 2, subfamily S, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA069248-100UL
Sigma-Aldrich
Anti-CYP2S1 antibody produced in rabbit (C15-1465-634)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to cytochrome P450 family 2 subfamily S member 1 Sequence GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL Application All Prestige Antibodies Powered by Atlas -
HPA041622-100UL
Sigma-Aldrich
Anti-CYP2U1 antibody produced in rabbit (C15-1456-797)
Price: $928.29List Price: $1,031.43Immunogen cytochrome P450, family 2, subfamily U, polypeptide 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA046754-100UL
Sigma-Aldrich
Anti-CYP2U1 antibody produced in rabbit (C15-1458-978)
Price: $928.29List Price: $1,031.43Immunogen cytochrome P450, family 2, subfamily U, polypeptide 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA064827-100UL
Sigma-Aldrich
Anti-CYP2U1 antibody produced in rabbit (C15-1464-744)
Price: $928.29List Price: $1,031.43Immunogen cytochrome P450, family 2, subfamily U, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most