-
HPA024621-100UL
Anti-ADAM2 antibody produced in rabbit (C15-1450-822)
Price: $879.43List Price: $977.14The gene ADAM2 (disintegrin and metalloproteinase domain-containing protein 2) is mapped to human chromosome 8p11. It belongs to the ADAM family of proteins. -
HPA026581-100UL
Anti-ADAM2 antibody produced in rabbit (C15-1451-113)
Price: $879.43List Price: $977.14The gene ADAM2 (disintegrin and metalloproteinase domain-containing protein 2) is mapped to human chromosome 8p11. It belongs to the ADAM family of proteins. -
HPA059377-100UL
Anti-ADAM20 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ADAM metallopeptidase domain 20 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA035973-100UL
Anti-ADAMTS12 antibody produced in rabbit (C15-1454-123)
Price: $928.29List Price: $1,031.43Immunogen ADAM metallopeptidase with thrombospondin type 1 motif, 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA075079-100UL
Anti-ADAMTS12 antibody produced in rabbit (C15-1466-671)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ADAM metallopeptidase with thrombospondin type 1 motif 12 Sequence SYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETK Application All Prestige Antibodies Powered -
HPA028363-100UL
ANTI-ADAMTS2 ANTIBODY PRODUCED IN RABBIT (C15-1451-795)
Price: $977.14List Price: $1,085.71Immunogen ADAM metallopeptidase with thrombospondin type 1 motif 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA028444-100UL
Anti-ADAMTS2 antibody produced in rabbit (C15-1451-839)
Price: $879.43List Price: $977.14Immunogen ADAM metallopeptidase with thrombospondin type 1 motif, 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA045634-100UL
Anti-ADAMTSL2 antibody produced in rabbit (C15-1458-591)
Price: $928.29List Price: $1,031.43Immunogen ADAMTS-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA053812-100UL
Anti-ADAMTSL2 antibody produced in rabbit (C15-1461-463)
Price: $928.29List Price: $1,031.43Immunogen ADAMTS-like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA035479-100UL
Anti-ADAT2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen adenosine deaminase, tRNA-specific 2, TAD2 homolog ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
HPA036036-100UL
Anti-ADCK2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43The gene ADCK2 (uncharacterized aarF domain-containing protein kinase 2) is mapped to human chromosome 7q34. It associates with the molecules of CoQ10 (coenzyme Q10) biosynthesis pathway. -
HPA038015-100UL
Anti-ADCY2 antibody produced in rabbit (C15-1455-025)
Price: $928.29List Price: $1,031.43Immunogen adenylate cyclase 2 (brain) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are