Secondary Antibodies

Immunogen elongin A3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

EMC2 (ER membrane protein complex subunit 2) is a &#876440kDa novel non-membrane-spanning protein. The study shows that EMC2 may possess a novel putative O-linked glycosyl transferase.

Immunogen Recombinant protein corresponding to elastin microfibril interfacer 2 Sequence RMLNGRLDNEFDRLIVPEPDVDFDAKWNELDARINVTEKNAEEHCFYIEETLRGAINGEVGDLKQLVDQKIQSLEDRLGSVLLQMTNNT Application All Prestige Antibodies Powered by Atlas Antibodies are

Echinoderm microtubule-associated protein-like 2 (EML2) is a 70kDa protein which contains a hydrophobic ELP (HELP) domain and a large tryptophan-aspartic acid (WD) repeat domain. The gene encoding it is present on chromosome 19.

Immunogen engrailed homeobox 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen engrailed homeobox 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

A member of the Endophilin family, Endophilin A1 is a protein containing SH3 domains, and has been implicated in the trafficking of clathrin-mediated synaptic vesicle endocytosis within the membrane. It was originally characterized as a

Specificity Recognizes endothelin ET-1 (10% cross-reactivity with ET-3) and when used in conjunction with CBL87 (anti-endothelin C-terminus) has a sensitivity of 0.06 pmol/L for ET-1.

Immunogen ectonucleotide pyrophosphatase/phosphodiesterase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ENTH domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

The gene ENY2 (enhancer of yellow 2 transcription factor homolog) is mapped to human chromosome 8q23-q24. It is part of the TFTC/STAGA (TBP-free TAF complex (TFTC) and SPT3/TAF9/GCN5 acetyltransferase (STAGA)) complex.

Immunogen EPS8-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most