Secondary Antibodies

FMR1 is a RNA binding protein expressed mainly in brain, neurons, placenta, testes and lymphocytes. Defect in FMR1 can lead to Fragile X Mental Retardation Syndrome due to lack of expression of FMR1 or expression of a mutant protein that cannot

Immunogen fibronectin type III domain containing 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen folliculin interacting protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen folliculin interacting protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Recombinant protein corresponding to folliculin interacting protein 2 Sequence GFQENVCCPQNRLSEGDEGESDKGFAEDRGSRNDMAADIAGQLSHAADLGTASHGAGGTGGRRLEATRGLYVKAAEGPVLE Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen Fos-related antigen 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen FOS-like antigen 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

FOXC2 belongs to the forkhead transcription factor family and has a distinct DNA-binding forkhead domain. Increased expression of FOXC2 is known to prevent hypertriglyceridemia and insulin resistance induced by diet.

FOXJ2 (forkhead box J2) is a mammalian fork head transcription factor, which has a wide range of adult tissue expression. It is also expressed during the cleavage stages of pre-implantation development.

Forkhead box protein K2 (UniProt Q01167 also known as FOXK2, Cellular transcription factor ILF-1, Interleukin enhancer-binding factor 1) is encoded by the FOXK2 (also known as ILF, ILF-1, ILF1) gene (Gene ID 3607) in human. FOXK2 is a

Forkhead box protein L2 (FOXL2) is a fork-head transcription factor that is expressed in developing gonad and in granulosa cells of the mature ovary. It plays a role in repressing the development of testis, and facilitating the differentiation and

Formyl peptide receptors (FPRs) are G protein coupled receptors critical for our immune response and the cellular activation and or suppression of immune cell activities. N-formyl peptides are produced by the degradation of either bacteria or host