Secondary Antibodies

Glutamic-oxaloacetic transaminase 1, soluble (GOT1) is an enzyme that is involved in the metabolism of amino acids. It is also involved in tricarboxylic acid and area cycles.

Immunogen glutamic-oxaloacetic transaminase 1, soluble Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen glutamic-oxaloacetic transaminase 1, soluble Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Synthetic peptide directed towards the N terminal region of human GOT2 Biochem/physiol Actions Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms,

The gene glutamate oxaloacetate transaminase-2 (GOT2) is located in human chromosome 16 (16q21). The protein is an aspartate aminotransfaerase (AST) enzyme.

Immunogen G protein-coupled receptor 162 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

G-protein signaling modulator 2 (GPSM2) gene encodes a member of a family of proteins that function in the activation of G proteins. It contains 10 leu-gly-asn (LGN) repeats at the N-terminal and four G&#945i/o–Loco (GoLoco) motifs at the

Immunogen G-protein-signaling modulator 2 recombinant protein epitope signature tag (PrEST) Sequence FQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLKTSSVPVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFD Application All Prestige Antibodies Powered

Immunogen Synthetic peptide directed towards the C terminal region of human GPT2 Application Anti-GPT2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0&#956g/ml.

Immunogen glutamic pyruvate transaminase (alanine aminotransferase) 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen GRAM domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen GRB2-related adapter protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are