-
HPA023211-100UL
Sigma-Aldrich
Anti-GRPEL2 antibody produced in rabbit (C15-1450-299)
Price: $879.43List Price: $977.14Heat shock protein-70 works along with cochaperons, specifically J-domain proteins and nucleotide exchange factors (NEFs), which enhances ATP hydrolysis and ADP-ATP exchange. The human cells express two mitochondrial NEF isoforms: -
HPA059421-100ULImmunogen glutaredoxin, cysteine rich 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in
-
HPA043011-100ULImmunogen goosecoid homeobox 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by
-
HPA000869-100ULGeneral transcription factor IIA subunit 1 is a protein encoded by the GTF2A1 gene in humans. The gene is mapped to human chromosome 14q31.
-
HPA056239-100ULImmunogen general transcription factor IIA, 2, 12kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA061626-100ULImmunogen general transcription factor IIB Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in
-
HPA004816-100UL
Sigma-Aldrich
Anti-GTF2E2 antibody produced in rabbit (C15-1446-275)
Price: $879.43List Price: $977.14Immunogen general transcription factor IIE, polypeptide 2, beta 34kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA025065-100UL
Sigma-Aldrich
Anti-GTF2E2 antibody produced in rabbit (C15-1450-928)
Price: $879.43List Price: $977.14The gene GTF2E2 (general transcription factor IIE subunit 2) is mapped to human chromosome 8p12. The protein has a serine-rich region, a centrally located forkhead domain, a leucine repeat motif, a region similar to the bacterial σ factor -
AV100810-100UL
Sigma-Aldrich
Anti-GTF2F1 antibody produced in rabbit (C15-1340-567)
Price: $936.00List Price: $1,040.00Immunogen Synthetic peptide directed towards the N terminal region of human GTF2F1 Application Anti-GTF2F1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. Biochem/physiol Actions GTF2F1 is a -
HPA022793-100UL
Sigma-Aldrich
Anti-GTF2F1 antibody produced in rabbit (C15-1450-135)
Price: $879.43List Price: $977.14GTF2F1 (General transcription factor IIF, polypeptide 1, 74kDa) is a 74kDa, RNA polymerase II-associated protein (RAP). Structurally, the ⓬⓶ heterotetrameric structure consists of two 28kDa (RAP30, TFIIFβ) and two 58kDa (RAP74, -
HPA028707-100UL
Sigma-Aldrich
Anti-GTF2F1 antibody produced in rabbit (C15-1451-972)
Price: $879.43List Price: $977.14Immunogen general transcription factor IIF, polypeptide 1, 74kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA070752-100UL
Sigma-Aldrich
Anti-GTF2F1 antibody produced in rabbit (C15-1465-902)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to general transcription factor IIF subunit 1 Sequence SLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNP Application All Prestige Antibodies Powered by Atlas Antibodies are