Secondary Antibodies

Heat shock protein-70 works along with cochaperons, specifically J-domain proteins and nucleotide exchange factors (NEFs), which enhances ATP hydrolysis and ADP-ATP exchange. The human cells express two mitochondrial NEF isoforms:

Immunogen glutaredoxin, cysteine rich 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen goosecoid homeobox 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

General transcription factor IIA subunit 1 is a protein encoded by the GTF2A1 gene in humans. The gene is mapped to human chromosome 14q31.

Immunogen general transcription factor IIA, 2, 12kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen general transcription factor IIB Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen general transcription factor IIE, polypeptide 2, beta 34kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

The gene GTF2E2 (general transcription factor IIE subunit 2) is mapped to human chromosome 8p12. The protein has a serine-rich region, a centrally located forkhead domain, a leucine repeat motif, a region similar to the bacterial &#963 factor

Immunogen Synthetic peptide directed towards the N terminal region of human GTF2F1 Application Anti-GTF2F1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 &#956g/ml. Biochem/physiol Actions GTF2F1 is a

GTF2F1 (General transcription factor IIF, polypeptide 1, 74kDa) is a 74kDa, RNA polymerase II-associated protein (RAP). Structurally, the &#9452&#9462 heterotetrameric structure consists of two 28kDa (RAP30, TFIIF&#946) and two 58kDa (RAP74,

Immunogen general transcription factor IIF, polypeptide 1, 74kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Recombinant protein corresponding to general transcription factor IIF subunit 1 Sequence SLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNP Application All Prestige Antibodies Powered by Atlas Antibodies are