Secondary Antibodies

Immunogen interphotoreceptor matrix proteoglycan 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to INO80 complex subunit B Sequence GQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREER Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Insm transcriptional repressor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen insulinoma-associated 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen insulinoma-associated 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Specificity Human integrin alpha Iib Immunogen Epitope: cytoplasmic domain Synthetic peptide corresponding to the cytoplasmic domain of human integrin alphaIIb conjugated to KLH. (a.

Specificity This antibody recognizes the CD18 molecule, a 95 kDa integrin molecule (beta 2 integrin) that forms the common beta chain of the CD11/CD18 heterodimer integrins which are expressed on all leucocytes. The beta2 integrin is the ICAM 1

Interleukin-10 (IL-10), originally known as Cytokine Synthesis Inhibitory Factor (CSIF) is an 18.7 kDa protein of 160 amino acid residues that shares over 80% sequence homology with the Epstein-Barr Virus protein BCRFI.

Immunogen integrator complex subunit 12 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Immunohistochemistry (1

Immunogen integrator complex subunit 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen integrator complex subunit 14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen integrator complex subunit 14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are