Secondary Antibodies

Immunogen integrator complex subunit 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to integrator complex subunit 7 Sequence GDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVA Application All Prestige Antibodies Powered by Atlas Antibodies are

Specificity IP3 Receptor 2. Immunogen Synthetic peptide from the C terminus of human IP3 Receptor 2.

Immunogen IQ motif containing GTPase activating protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen IQ motif containing GTPase activating protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen IQ motif and Sec7 domain 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Interleukin-1 receptor-associated kinase-like 2 (IRAK-2) binds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization. IRAK-2 also mediates

Immunogen interleukin-1 receptor-associated kinase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Interferon regulatory factor 1 (IRF1) is a transcription factor and gene trans-activator that activates interferon-&#946 and various other target gene expression to help regulate cell processes such as the immune response, apoptosis, and tumor

Iron regulatory proteins (IRP-1 and IRP-2) are cytoplasmic mRNA-binding proteins that control intracellular iron levels by regulating the translation of ferritin, Tfrs, and other proteins congaing iron-responsive element (IRE) located at the

Immunogen iron-sulfur cluster assembly 2 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen Interferon-stimulated 20 kDa exonuclease-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as