Secondary Antibodies

Immunogen Recombinant protein corresponding to junctional adhesion molecule 2 Sequence GVCYAQRKGYFSKETSFQKSNSSSKATTMS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Recombinant protein corresponding to junctional adhesion molecule 2 Sequence SCEARNSVGYRRCPGKRMQVDDLNI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Protein Jumonji (Jarid2), also known as Jumonji/ARID domain-containing protein 2, and encoded by the gene name Jarid2 is a member of the JARID2 family. Jarid 2 is a regulator of histone methyltransferase complexes, and therefore plays an essential

Immunogen Jun dimerization protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Histone N(&#1013)-methyl lysine demethylases are important in epigenetic regulation. JMJD2E (KDM4E) also known as Lysine-specific demethylase 4E, histone lysine demethylase 4E, or KDM4D-like protein, and encoded by the gene KDM4E/KDM4DL, is a

Immunogen JmjC domain-containing protein 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Covalent modification of histones plays critical role in regulating chromatin structure and transcription. JMJD8 is one member of the family of JmjC domain-containing histone demethylation (JHDM) enzymes.

Immunogen junctophilin 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Transporters and exchangers play a critical role in the generation and dissipation of action potentials in nerve cells and in the maintenance of normal cell volume. They are also involved in a variety of mechanisms pertaining to the control of

KN motif and ankyrin repeat domains 2 (KANK2) belongs to the KANK family. This protein is made up of an N-terminal KN motif, a coiled-coil domain and an ankyrin domain.

Immunogen Uncharacterized protein C12orf41 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen KAT8 regulatory NSL complex subunit 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive