-
HPA054586-100UL
Sigma-Aldrich
Anti-KRT222 antibody produced in rabbit (C15-1461-725)
Price: $928.29List Price: $1,031.43Immunogen keratin 222 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA068724-100UL
Sigma-Aldrich
ANTI-KRT222 ANTIBODY PRODUCED IN RABBIT (C15-1465-528)
Price: $977.14List Price: $1,085.71Immunogen keratin 222 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA069774-100UL
Sigma-Aldrich
Anti-KRT222 antibody produced in rabbit (C15-1465-748)
Price: $928.29List Price: $1,031.43Immunogen keratin 222, type II Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA012050-100UL
Sigma-Aldrich
Anti-KRT23 antibody produced in rabbit (C15-1447-719)
Price: $879.43List Price: $977.14Immunogen Keratin, type I cytoskeletal 23 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA016959-100UL
Sigma-Aldrich
Anti-KRT23 antibody produced in rabbit (C15-1448-642)
Price: $879.43List Price: $977.14Immunogen Keratin, type I cytoskeletal 23 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA007272-100ULKRT7 (Keratin, type II cytoskeletal 7) gene encodes a type II cytokeratin with a molar mass of 55kDa. It is expressed during the differentiation of simple and stratified epithelial tissues.
-
HPA049404-100ULImmunogen keratin 71 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA065523-100ULImmunogen keratin 72, type II Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA048596-100ULImmunogen keratin 74 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA059203-100ULImmunogen keratin associated protein 2-4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in
-
HPA031203-100UL
Sigma-Aldrich
Anti-KTI12 antibody produced in rabbit (C15-1453-027)
Price: $889.20List Price: $988.00Immunogen Recombinant protein corresponding to KTI12 chromatin associated homolog Sequence DQVTSQVLAGLMEAQKSAVPGGLLTLPGTTEHLRFTRPLTMAELSRLRRQFISYTKMHPNNENLPQLANMFLQYLSQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
HPA031204-100UL
Sigma-Aldrich
Anti-KTI12 antibody produced in rabbit (C15-1453-028)
Price: $889.20List Price: $988.00Immunogen KTI12 homolog, chromatin associated (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and