Secondary Antibodies

Immunogen melanoma antigen family C, 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen melanoma antigen family D, 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen melanoma antigen family D, 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen mastermind-like 2 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Alpha-mannosidase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

MAN2A2 (Mannosidase, &#945, class 2A, member 2) is a type II membrane protein localized in the cisternae of the Golgi bodies. It exists in several isoforms: lysosomal &#945-mannosidase, endoplasmic reticulum &#945-mannosidase, cytoplasmic

Immunogen Recombinant protein corresponding to mannosidase alpha class 2A member 2 Sequence TLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTRTSKD Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen mannosidase, alpha, class 2B, member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen mannosidase, alpha, class 2C, member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen mannosidase, alpha, class 2C, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Microtubule-associated protein 2 (UniProt: P15146 also known as MAP-2) is encoded by the Map2 (also known as Mtap2) gene (Gene ID: 25595) in rat. MAP-2 belong to the family of thermostable proteins associated with microtubules.

Specificity MAP2 [Microtubule associated protein 2] Other species have not yet been tested. It is expected that the antibody will also react with human due to immunogen sequence similarity.