Secondary Antibodies

Specificity Microtubule Associated Protein 2 (MAP2). It is expected that the antibody will react with all mammals.

Immunogen Microtubule-associated protein 2 recombinant protein epitope signature tag (PrEST) Sequence SLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVK

Immunogen microtubule associated protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

MAP2 gene is located at 2q34 on the human chromosome. Microtubule-associated protein 2 (MAP2) is a major cytoskeletal protein in neurons belonging to a family of heat stable microtubule-associated proteins.

Immunogen Dual specificity mitogen-activated protein kinase kinase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen mitogen-activated protein kinase kinase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen mitogen-activated protein kinase kinase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen mitogen-activated protein kinase kinase 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Mitogen-activated protein kinase kinase 5 (MAP2K5) is part of the mitogen-activated protein kinase family. The MAP2K5 gene encodes three protein-coding transcripts, consists of 20 exons and is localized on human chromosome 15q23.

Immunogen mitogen-activated protein kinase kinase 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Dual specificity mitogen-activated protein kinase kinase 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen mitogen-activated protein kinase kinase 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive