Western Blotting Reagents

CRLF3 (cytokine receptor-like factor 3) gene is mapped to human chromosome 17q11.2 and is found to be frequently deleted in patients with Neurofibromatosis type 1 (NF1) microdeletions in the neurofibromin locus.

Immunogen Recombinant protein corresponding to DENN domain containing 4B Sequence PSPWLTPDPASVQVRLLWDVLTPDPNSCPPLYVLWRVHSQIPQRVVWPGPVPASLSLALLESVLRHVGLNEVHKAVGLLLETLG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

DENND4C (DENN/MADD domain containing 4C) is a member of the DENND4 subfamily of DENND proteins. It resides in the cytosol, and contains the characteristic DENN domain, which acts as the GEF (guanine nucleotide exchange factor) domain.

DENND4C (DENN/MADD domain containing 4C) is a member of the DENND4 subfamily of DENND proteins. It resides in the cytosol, and contains the characteristic DENN domain, which acts as the GEF (guanine nucleotide exchange factor) domain.

The gene FAM116B (DENN domain-containing protein 6B) is mapped to human chromosome 22q13.33.

DENND6B (DENN/MADD domain containing 6B) is a member of DENN (Differentially expressed in normal and neoplastic cells) domain protein family. It is located on chromosome 5.

Immunogen family with sequence similarity 116, member B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen fibrosin-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen formin binding protein 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen formin binding protein 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen guanylate binding protein family, member 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen kelch repeat and BTB (POZ) domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a