-
HPA051400-100UL
Anti-RER1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen retention in endoplasmic reticulum sorting receptor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA068942-100UL
Anti-RP11-302B13.5 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to Sequence YKPSSEPLGSPRSSKREPRSLSGTSLTDMSKLSVTGGNPEVLTTGFVEGSRVRS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA034600-100UL
Anti-RPL4 antibody produced in rabbit
Price: $889.20List Price: $988.00Immunogen ribosomal protein L4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA003372-100UL
Anti-RPL9 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen 60S ribosomal protein L9 recombinant protein epitope signature tag (PrEST) Application Anti-RPL9 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is -
HPA003368-100UL
Anti-RPLP1 antibody produced in rabbit
Price: $879.43List Price: $977.14RPLP1 (ribosomal protein, large, P1) gene encodes an acidic ribosomal phosphoprotein that forms a component of the large 60s subunit of the ribosomes that are involved in protein synthesis. The protein is a member of the L12P family of ribosomal -
HPA052511-100UL
Anti-RTBDN antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen retbindin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA064887-100UL
Anti-RTP4 antibody produced in rabbit (C15-1464-766)
Price: $928.29List Price: $1,031.43Immunogen receptor (chemosensory) transporter protein 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA071189-100UL
Anti-RTP4 antibody produced in rabbit (C15-1465-994)
Price: $928.29List Price: $1,031.43Immunogen receptor (chemosensory) transporter protein 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA038804-100UL
Anti-RUFY1 antibody produced in rabbit (C15-1455-451)
Price: $928.29List Price: $1,031.43Immunogen RUN and FYVE domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA057614-100UL
Anti-RUFY1 antibody produced in rabbit (C15-1462-711)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to RUN and FYVE domain containing 1. Sequence NLQMFHKAQNAESSLQQKNEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKEL Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA022952-100UL
Anti-RUFY3 antibody produced in rabbit (C15-1450-185)
Price: $879.43List Price: $977.14Immunogen RUN and FYVE domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA022970-100UL
Anti-RUFY3 antibody produced in rabbit (C15-1450-194)
Price: $879.43List Price: $977.14The gene RUFY3 (RUN and FYVE domain containing 3) is mapped to human chromosome 4q13. It is strongly expressed in brain tissue.