-
HPA037980-100UL
Anti-RUFY4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen RUN and FYVE domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA038965-100UL
Anti-WBP4 antibody produced in rabbit (C15-1455-530)
Price: $928.29List Price: $1,031.43Immunogen WW domain binding protein 4 (formin binding protein 21) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA058738-100UL
Anti-WBP4 antibody produced in rabbit (C15-1463-037)
Price: $928.29List Price: $1,031.43Immunogen WW domain binding protein 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA036434-100UL
Anti-WDR1 antibody produced in rabbit (C15-1454-352)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA070293-100UL
Anti-WDR1 antibody produced in rabbit (C15-1465-816)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to WD repeat domain 1 Sequence KLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
HPA038980-100UL
Anti-WDR11 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA050193-100UL
Anti-WDR18 antibody produced in rabbit (C15-1460-217)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA050200-100UL
Anti-WDR18 antibody produced in rabbit (C15-1460-219)
Price: $977.14List Price: $1,085.71Immunogen WD repeat domain 18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA017381-100UL
Anti-WDR4 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen WD repeat-containing protein 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA036840-100UL
Anti-WDSUB1 antibody produced in rabbit (C15-1454-578)
Price: $928.29List Price: $1,031.43Immunogen WD repeat, sterile alpha motif and U-box domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA058172-100UL
Anti-WDSUB1 antibody produced in rabbit (C15-1462-853)
Price: $928.29List Price: $1,031.43Immunogen WD repeat, sterile alpha motif and U-box domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
5313700001
BMP-2 SIGNALING ENHANCER A01 (C15-1305-051)
Price: $396.73List Price: $440.82A cell-permeable phenylsulfonyl-piperazinyl compound that enhances BMP-2 associated signaling by selectively inhibiting Smurf1-mediated Smad1/5 ubiquitination and thereby prolonging the half life of Smad1 and 5. Directly and specifically blocks WW