Chemical Reagents

GAS2-like protein 1 (UniProt: Q99501-1 also known as GAS2-related protein on chromosome 22, Growth arrest-specific protein 2-like 1, GAS2L1) is encoded by the GAS2L1 (also known as GAR22) gene (Gene ID: 10634) in human. GAS2L1 belongs to the

Immunogen Recombinant protein corresponding to GAS2-like protein 1 Sequence RLSRVSSPSPELGTTPASIFRTPLQLDPQQEQQLFRRLEEEFLANARALEAVASVTPTGPAPDPARAPDPPAPDSAYCSSSSSSSSLSVLGGKCG Application All Prestige Antibodies Powered by Atlas Antibodies are

Sb₂O₃ CAS#: 1309-64-4 F.W.: 291.50

Sb₂O₃ CAS#: 1309-64-4 F.W.: 291.50

Sb₂O₃ CAS#: 1309-64-4 F.W.: 291.50

Sb₂O₃ CAS#: 1309-64-4 F.W.: 291.50

Sb₂O₄ CAS#: 1332-81-6 F.W.: 307.50

Sb₂O₄ CAS#: 1332-81-6 F.W.: 307.50

Sb₂O₅ CAS#: 1314-60-9 F.W.: 323.50

Sb₂O₅ CAS#: 1314-60-9 F.W.: 323.50

Concentration 1,000 +/- 10 ug/ml Matrix: &lt20% HCl NIST Traceable

Concentration 1,000 +/- 10 ug/ml Matrix: &lt20% HCl NIST Traceable