Anidulafungin

8-iso-17-phenyl PGF2&beta is an isomer of bimatoprost (free acid) that is epimerized at the 8 and 9 positions. There are no published reports on the biological activity of 8-iso-17-phenyl PGF2&beta.

Ancymidol, a-cyclopropyl-a-(4-methoxyphenyl)-5-pyrimidinemethanol (EL-53 1), a plant growth retardant is a synthetic pyrimidine analogue. It is also a weak fungitoxic.

Ancymidol, a-cyclopropyl-a-(4-methoxyphenyl)-5-pyrimidinemethanol (EL-53 1), a plant growth retardant is a synthetic pyrimidine analogue. It is also a weak fungitoxic.

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the

Annexin A1 (ANXA1) belongs to the annexin gene family and is a part of the A subfamily. It is a glucocorticoid-regulated, calcium and phospholipid-binding protein.

Annexin A10 (ANXA10) belongs to the annexin A family, which binds to phospholipids in a calcium-regulated manner. Annexins generally contain a Ca 2+ -binding region which forms the C-terminal core domain, made of annexin repeats.

Immunogen Annexin A11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Recombinant protein corresponding to annexin A2 Sequence MGRQLAGCGDAGKKASFKMSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen Recombinant protein corresponding to annexin A2 Sequence YDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen Synthetic peptide directed towards the N terminal region of human ANXA4 Biochem/physiol Actions Annexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not

Immunogen Synthetic peptide directed towards the N terminal region of human ANXA6 Biochem/physiol Actions ANXA6 is a calcium-dependent, phospholipid-binding protein that belongs to the annexin family. It inhibits the activity of cytoplasmic

Anti-FXYD7 FXYD domain containing ion transport regulator 7,