-
Add to Cart The item has been addedHPA048349-100ULAnti-SPACA7
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to sperm acrosome associated 7 Sequence AGIDENYQAGGSENYHELLENLQFSPGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQYENLSILDQIL Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedC2780-5UNChondroitinase AC from Flavobacterium heparinum (C15-1291-743)
Price: $877.71List Price: $975.24Application Chondroitinase AC from Sigma has been used for the large scale preparation of glycosaminoglycan (GAG) fractions during the study of structural and sequence motifs in dermatan sulfate. Chondroitinase AC has been applied to the analysis -
Add to Cart The item has been addedE2039-10UNChondroitinase AC from Flavobacterium heparinum (C15-1291-744)
Price: $1,186.29List Price: $1,318.10Application Chondroitinase AC from Flavobacterium heparinum is an enzyme that cleaves sulfated and non-sulfated polysaccharide chains with (1-4) linkages between hexosamines and glucuronic acid residues, by an elimination mechanism. The resulting -
Add to Cart The item has been addedC8058-50UNChondroitinase B from Flavobacterium heparinum
Price: $1,222.29List Price: $1,358.10Application Chondroitinase B from Flavobacterium heparinum has been used in a study to assess the structural characterization and antithrombin activity of dermatan sulfate. Chondroitinase B from Flavobacterium heparinum has also been used in a -
Add to Cart The item has been addedAPrEST83045-100PrEST Antigen ARG1 arginase 1, 100ul UN 1687 6.1 PG2 (C08-0216-563)
Price: $537.65List Price: $597.39PrEST Antigen ARG1 arginase 1, 100ul UN 1687 6.1 PG2
