-
AV51819-100UL
ANTI-ASB11
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the C terminal region of human ASB11 Sequence Synthetic peptide located within the following region: GQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSV Physical form Purified antibody supplied in 1x PBS -
ABE1320
Anti-ASXL2 (C15-1316-875)
Price: $666.86List Price: $740.95Putative Polycomb group protein ASXL2 (UniProt: Q76L83 also known as Additional sex combs-like protein 2) is encoded by the ASXL2 (also known as ASXH2, KIAA1685) gene (Gene ID: 55252) in human. ASXL2 is a putative Polycomb group (PcG) protein that