-
Add to Cart The item has been added693065-100MG(R)-BINAP (C15-1279-283)
Price: $69.50List Price: $77.22Application Takasago Ligands and Complexes for Asymmetric Reactions ( R )-BINAP reacts with allylpalladium(II) chloride dimer to form a BINAP-palladium catalyst, which can catalyze the asymmetric allylation of 1,3-diketones to form chiral -
Add to Cart The item has been added693065-500MG(R)-BINAP (C15-1279-284)
Price: $162.45List Price: $180.50Application Takasago Ligands and Complexes for Asymmetric Reactions ( R )-BINAP reacts with allylpalladium(II) chloride dimer to form a BINAP-palladium catalyst, which can catalyze the asymmetric allylation of 1,3-diketones to form chiral -
Add to Cart The item has been added693057-100MG(S)-BINAP (C15-1279-287)
Price: $56.46List Price: $62.73Application Takasago Ligands and Complexes for Asymmetric Reactions Reactant involved in: Enantioselective and diastereoselective unpoled carbonyl allylation Syntehsis of organophophine oxides as anittumor agents SN2 halogenation of hydroxy groups -
Add to Cart The item has been added693057-500MG(S)-BINAP (C15-1279-288)
Price: $201.32List Price: $223.69Application Takasago Ligands and Complexes for Asymmetric Reactions Reactant involved in: Enantioselective and diastereoselective unpoled carbonyl allylation Syntehsis of organophophine oxides as anittumor agents SN2 halogenation of hydroxy groups -
Add to Cart The item has been addedHPA003894-25ULANTI-BIN1
Price: $540.00List Price: $600.00Immunogen Myc box-dependent-interacting protein 1 recombinant protein epitope signature tag (PrEST) Sequence SSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP Application All Prestige
