-
HPA005565-25ULImmunogen Cell division cycle-associated protein 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA031157-25ULImmunogen DDB1 and CUL4 associated factor 11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA055945-25ULSignaling lymphocytic activation molecule F7 (SLAMF7) protein is a member of the SLAM family and is expressed on macrophages, natural killer (NK) cells, monocytes, dendritic cells, and pro-B cells. The SLAMF7 gene is located on the human chromosome
-
HPA042710-100ULImmunogen Recombinant protein corresponding to WAP four-disulfide core domain 8 Sequence KHKPGLCPKERLTCTTELPDSCNTDFDCKEYQKCCFFACQKKCMDPFQEPCMLPVRHGNCNHEAQRWHFDFKNYRCTPFKYRGCEGNA Application All Prestige Antibodies Powered by Atlas Antibodies are
-
HPA071119-100ULImmunogen Recombinant protein corresponding to WAP four-disulfide core domain 8 Sequence GQCPLFPFTERKECPPSCHSDIDCPQTDKCCESRCGFVCARAWTVKKGFCPRKPLLCTKIDKPKCLQDEECPLVEKCCSHCGLKCMDPR Application All Prestige Antibodies Powered by Atlas Antibodies are
-
C8511-100UNApplication Cathepsin C has been used in a study that demonstrated the potential of a proteomics approach to identify novel proteins expressed by extravillous trophoblast and to uncover the mechanisms leading to disease states in pregnancy.
-
C8511-10UNApplication Cathepsin C has been used in a study that demonstrated the potential of a proteomics approach to identify novel proteins expressed by extravillous trophoblast and to uncover the mechanisms leading to disease states in pregnancy.
-
C8511-25UNApplication Cathepsin C has been used in a study that demonstrated the potential of a proteomics approach to identify novel proteins expressed by extravillous trophoblast and to uncover the mechanisms leading to disease states in pregnancy.
-
219360-1MGAn internally quenched fluorogenic 11 amino acid peptide that acts as a sensitive and selective substrate for cathepsins D and E (k cat /K m = 15.6 µM -1 s -1 and 10.
-
219415-1MGCell-permeable cysteine protease inhibitor. Inhibits cathepsin B (k 2 /K i = 8.
-
219421-1MG
Sigma-Aldrich
Cathepsin L Inhibitor I - CAS 108005-94-3 - Calbiochem
Price: $292.04List Price: $324.49A potent, cell-permeable and irreversible inhibitor of cathepsin L. A potent, cell-permeable, and irreversible inhibitor of Cathepsin L (Cat. -
219677-10MG
Sigma-Aldrich
CFTR Inhibitor IV, PPQ-102 - CAS 931706-15-9 - Calbiochem
Price: $475.71List Price: $528.57A cell-permeable pyrimido-pyrrolo-quinoxalinedione (PPQ) compound that targets the intracellular nucleotide binding domain(s) of CFTR and inhibits CFTR-mediated chloride current in a reversible and voltage-independent manner. Single channel