Cefadroxil hemihydrate

Immunogen Recombinant protein corresponding to cadherin related family member 4 Sequence ATLDYKLWFRSSSNPASLCLYDRVLEVNATLDCDTPGACFQHAASILVLDGGQPQMTTEVPVLVMVTPINEFSPACAPRTFRVQE Application All Prestige Antibodies Powered by Atlas Antibodies are

Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of rare and unique chemicals. Sigma-Aldrich does not collect analytical data for this product.

Application Employed in a synthesis of thioxothiazolidines from primary amines and carbon disulfide.

Application Employed in a synthesis of thioxothiazolidines from primary amines and carbon disulfide.

Application Employed in a synthesis of thioxothiazolidines from primary amines and carbon disulfide.

Native L-leucine dehydrogenase from Bacillus cereus . Catalyzes the NAD + -dependent conversion of L-leucine to &#945-ketoisocaproate.

Nordihydroguaiaretic acid (NDGA) is used as an antioxidant and potent scavenger of reactive oxygen species (ROS). Application Nordihydroguaiaretic acid can be used: In the synthesis of nordihydroguaiaretic acid derivatives with potent HIV

Nordihydroguaiaretic acid (NDGA) is used as an antioxidant and potent scavenger of reactive oxygen species (ROS). Application Nordihydroguaiaretic acid can be used: In the synthesis of nordihydroguaiaretic acid derivatives with potent HIV

Titration Septum for DL31 and DL32 Coulometric Titrators. Pack of 12 Mettler products are intended for sale/shipment within the US only. International customers should contact their local Mettler distributor to place orders for Mettler products.

Triethylgermanium hydride (Ge(C 2 H 5 ) 3 H) may be prepared by a three step process: Ge(C 2 H 5 ) 3 Br reacted with Na to yield Ge 2 (C 2 H 5 ) 6 Ge 2 (C 2 H 5 ) 6 treated with Li to form Ge(C 2 H 5 ) 3 Li ammonolysis of Ge(C 2 H 5 ) 3 Li to give