Cefcanel

(±)-3-Benzyloxy-1,2-propanediol undergoes enantioseparation by ligand exchange micellar electrokinetic chromatography using borate anion as a central ion . Application (±)-3-Benzyloxy-1,2-propanediol was used in capillary electrophoretic

Application Employed in the synthesis of a cyclopropyl chiron used in the preparation of 2,3-methanoamino acids. Chiral building block in the synthesis of petrosynes and biologically important phospholipid analogs.

1,4-Butanediol divinyl ether is widely used as across-linking agent to synthesize polymeric membranes, copolymer networks, and microspheres. For example, it can be used as a precursor to synthesize electrolyte membranes for fuel cell applications

2-Benzyloxy-1,3-propanediol

2-Phenyl-1,2-propanediol

Application 2-Phenyl-1,3-propanediol may be used to synthesize enantiomers of 2-phenyl-3-hydroxypropylcarbamate, via a chemoenzymatic method. It may also be employed in the preparation of 2-phenyl-1,3-propanedithiol.

Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product.

Immunogen Synthetic peptide directed towards the C terminal region of human C15orf26 Biochem/physiol Actions The exact function of C15orf26 remains unknown. Sequence Synthetic peptide located within the following region:

Immunogen coiled-coil domain containing 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to cholecystokinin Sequence LQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

CCDA Selective Supplement is a mixture of two antibiotics (Amphotericin B &amp Cefoperazone) in lyophilized form. Amphotericin B largely reduces the growth of yeasts and molds, while Cefoperazone especially inhibits the growth of

Application An antimicrobial supplement recommended for the selective isolation of Campylobacter or Arcobacter species. Components (per vial, sufficient for 500 ml medium): Cefoperazone 16 mg Amphotericin B 5 mg