Cefcanel

Immunogen Recombinant protein corresponding to cholecystokinin Sequence LQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

CCDA Selective Supplement is a mixture of two antibiotics (Amphotericin B &amp Cefoperazone) in lyophilized form. Amphotericin B largely reduces the growth of yeasts and molds, while Cefoperazone especially inhibits the growth of

Application An antimicrobial supplement recommended for the selective isolation of Campylobacter or Arcobacter species. Components (per vial, sufficient for 500 ml medium): Cefoperazone 16 mg Amphotericin B 5 mg

Polyvinylcyclohexane

Tert-Butyl 1-Cyclobutyl-3-Hydroxypropan-2-Ylcarbamate.