-
Add to Cart The item has been addedHPA064308-100ULAnti-CENPF
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to centromere protein F Sequence CISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESLLNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQEL Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedABN2264-10ULAnti-SNTF (cleaved spectrin) (C15-1317-500)
Price: $307.10List Price: $341.22Spectrin alpha chain, non-erythrocytic 1 (UniProt: Q13813 also known as Alpha-II spectrin, Fodrin alpha chain, Spectrin, non-erythroid alpha subunit) is encoded by the SPTAN1 (also known as NEAS, SPTA2) gene (Gene ID: 6709) in human. Non-erythroid -
Add to Cart The item has been addedABN2264-50ULAnti-SNTF (cleaved spectrin) (C15-1317-501)
Price: $677.49List Price: $752.76Spectrin alpha chain, non-erythrocytic 1 (UniProt: Q13813 also known as Alpha-II spectrin, Fodrin alpha chain, Spectrin, non-erythroid alpha subunit) is encoded by the SPTAN1 (also known as NEAS, SPTA2) gene (Gene ID: 6709) in human. Non-erythroid -
Add to Cart The item has been addedAV100775-100ULANTI-TCF4
Price: $936.00List Price: $1,040.00TCF-4 belongs to the Tcf family of transcription factors that activate genes induced by the Wnt pathway. Immunogen Synthetic peptide directed towards the N terminal region of human TCF4 Application Anti-TCF4 (AB2) antibody produced in rabbit is -
Add to Cart The item has been added228191BD DifcoT Salmonella O Antiserum Group E Factors 1, 3, 10, 1
Price: $295.85List Price: $328.73BD DifcoT Salmonella O Antiserum Group E Factors 1, 3, 10, 1 -
Add to Cart The item has been added6420Enterobacteriaceae Count (PF/EB)
Price: $319.87List Price: $355.41An indicator in the 3M&trade Petrifilm&trade Enterobacteriaceae Count Plate colors all colonies red. The top film traps gas produced by some bacteria. -
Add to Cart The item has been added93062301-1VLIC-07 ANTI CHICKEN GALACTOCEREBROSIDE (C15-1313-592)
Price: $1,630.29List Price: $1,811.43Cell Line Origin Mouse P3-NS1/1-Ag4.1 x Mouse BALB/c spleen Cell Line Description The antibody is reported to be directed against galactocerebroside present on oligodendrocytes and Schwann cells. -
Add to Cart The item has been added22048-100G-Fkappa-Carrageenan (C15-1204-683)
Price: $277.35List Price: $308.16Carrageenans are mucopolysaccharides from the cell walls of the red algae. They are anionic linear polymers composed of 1,3α-1,4β-galactans having one (κ-), two (ι-) or three (λ-) sulfates per disaccharide unit. -
Add to Cart The item has been added22048-25G-Fkappa-Carrageenan (C15-1204-684)
Price: $125.06List Price: $138.96Carrageenans are mucopolysaccharides from the cell walls of the red algae. They are anionic linear polymers composed of 1,3α-1,4β-galactans having one (κ-), two (ι-) or three (λ-) sulfates per disaccharide unit. -
Add to Cart The item has been added906980-100MGPFN-Br
Price: $576.00List Price: $640.00We are committed to bringing you Greener Alternative Products, which adhere to one or more of The 12 Principles of Greener Chemistry. This product belongs to Enabling category of greener alternatives thus aligns with Design for energy efficency"." -
Add to Cart The item has been addedAPrEST82129-100PrEST Antigen AC004381.6 Putative RNA exonuclease NEF-sp , 1 (C08-0215-788)
Price: $537.65List Price: $597.39PrEST Antigen AC004381.6 Putative RNA exonuclease NEF-sp , 1 -
Add to Cart The item has been addedAPrEST82130-100PrEST Antigen AC004381.6 Putative RNA exonuclease NEF-sp , 1 (C08-0215-789)
Price: $537.65List Price: $597.39PrEST Antigen AC004381.6 Putative RNA exonuclease NEF-sp , 1
