-
Add to Cart The item has been addedHPA044341-25ULANTI-CIC
Price: $540.00List Price: $600.00Immunogen capicua transcriptional repressor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedAV40349-100ULAnti-CIRBP antibody produced in rabbit (C15-1341-222)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human CIRBP Biochem/physiol Actions CIRBP contains 1 RRM (RNA recognition motif) domain. It seems to play an essential role in cold-induced suppression of cell proliferation. -
Add to Cart The item has been addedHPA060537-100ULAnti-CIRBP antibody produced in rabbit (C15-1463-571)
Price: $928.29List Price: $1,031.43Immunogen cold inducible RNA binding protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA003317-25ULANTI-CUX1
Price: $540.00List Price: $600.00Immunogen cut-like homeobox 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA051339-100ULAnti-INCENP
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to inner centromere protein Sequence KLMEFLCNMDNKDLVWLEEIQEEAERMFTREFSKEPELMPKTPSQKNRRKKRRISYVQDENRDPIRRRLSRRKSRSSQLSSRRLRSKDSVEKLATVVGE Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedBR759005-100EABRAND(R) macro-cuvette (C15-1345-468)
Price: $54.86List Price: $60.95BRAND ® Macro cuvette is manufactured under controlled room conditions. Ideal for the determinations in water analysis, chemistry, and life science applications. -
Add to Cart The item has been addedBR759030-100EABRAND(R) macro-cuvette (C15-1345-470)
Price: $60.78List Price: $67.53BRAND ® Macro cuvette is manufactured under controlled room conditions. Ideal for the determinations in water analysis, chemistry, and life science applications. -
Add to Cart The item has been addedBR759035-500EABRAND(R) macro-cuvette (C15-1345-471)
Price: $229.29List Price: $254.76BRAND ® Macro cuvette is manufactured under controlled room conditions. Ideal for the determinations in water analysis, chemistry, and life science applications. -
Add to Cart The item has been addedBR759105-100EABRAND(R) macro-cuvette (C15-1345-472)
Price: $57.71List Price: $64.13BRAND ® Macro cuvette is manufactured under controlled room conditions. Ideal for the determinations in water analysis, chemistry, and life science applications. -
Add to Cart The item has been addedC1535-100MLCibacron Blue 3GA Agarose (C15-1346-363)
Price: $494.08List Price: $548.98Application Cibacron Blue 3GA-agarose is an agarose conjugate in saline suspension used in affinity chromatography, protein chromatography and dye resins. Physical form Suspension in 0. -
Add to Cart The item has been addedC1535-500MLCibacron Blue 3GA Agarose (C15-1346-364)
Price: $1,945.05List Price: $2,161.17Application Cibacron Blue 3GA-agarose is an agarose conjugate in saline suspension used in affinity chromatography, protein chromatography and dye resins. Physical form Suspension in 0. -
Add to Cart The item has been addedC1535-50MLCibacron Blue 3GA Agarose (C15-1346-365)
Price: $352.65List Price: $391.84Application Cibacron Blue 3GA-agarose is an agarose conjugate in saline suspension used in affinity chromatography, protein chromatography and dye resins. Physical form Suspension in 0.
