Cloxiqine or cloxyquin

Protein CLEC16A is a member of the CLEC16A/gop-1 family and is expressed in immune cells, including B-lymphocytes, natural killer cells, and dendritic cells. CLEC16A is not well understood however, it is likely that it plays a role in immunity.

Immunogen ClpB caseinolytic peptidase B homolog (E. coli) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen ClpX caseinolytic peptidase X homolog ( E. Coli ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen Recombinant protein corresponding to paired like homeobox 2b Sequence MEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTLRDHQS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

ORP SINGLE EPOXY

Application sBOX( t Bu) is a serine-derived chiral bisoxazoline ligand. The additional coordinating functionality provided by the esters enables new reactivity compared to traditional BOX ligands.