-
HPA043695-100UL
ANTI-P3H3
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to prolyl 3-hydroxylase 3 Sequence PMHLQMREDMAKYRRMSGVRPQSFRDLETPPHWAAYDTGLELLGRQEAGLALPRLEEALQGSLAQMESCRADCEGPEEQQGAEEEEDGAASQGGLYEAIAGH Application All Prestige Antibodies Powered by Atlas Antibodies -
1199960003
PHARMPREP P100 RP-18E 20â•¡M 1 PC
Price: $2,686.81List Price: $2,985.35Analysis Note Carbon content: 17 - 21 % Purity (Al): ≤ 50 ppm Purity (Fe): ≤ 25 ppm Purity (Na): ≤ 25 ppm Extractable matter: ≤ 0.10 % Specific surface area (BET): 320 - 400 m²/g Pore volume: 0. -
1612426-2X12MG
Sesame Oil Related Compound B
Price: $2,274.73List Price: $2,527.47This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the