Dequalinium

1,1'-Dioctadecyl-4,4'-bipyridinium dibromide

Immunogen Synthetic peptide directed towards the middle region of human C2 Biochem/physiol Actions Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b.

Immunogen DEP domain-containing protein 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies

HOXA13 is a homeobox transcription factor involved in embryonic development. This transcription factor is also involved in digit patterning in mice .

Immunogen Recombinant protein corresponding to leucine rich repeat containing 27 Sequence NRKVPLNPPGKMKPSKEKSPQASKEMSALQERNLEEKIKQHVLQMREQRRFHGQAPLEEMRKAAEDLEIATELQDEVLKLKLGL Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen Recombinant protein corresponding to leucine rich repeat containing 39 Sequence PEFIGRFQNLIVLDLSRNTISEIPPGIGLLTRLQELILSYNKIKTVPKELSNCASLEKLELAVNRDICDLPQELSNLL Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Immunogen Recombinant protein corresponding to leucine rich repeat containing 46 Sequence LDLSENLIETLKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLDGQPVVERWISDEEDEASSDEEFPELSGPFCSERGFLKELEQE Application All Prestige Antibodies Powered by Atlas Antibodies

Mis12 complex is composed of four subunits, Protein MIS12 homolog, Polyamine-modulated factor 1, Kinetochore-associated protein DSN1 homolog, and Kinetochore-associated protein NSL1 homolog (UniProt: Q9H081, Q6P1K2, Q9H410, Q96IY1, respectively)

Mis12 complex is composed of four subunits, Protein MIS12 homolog, Polyamine-modulated factor 1, Kinetochore-associated protein DSN1 homolog, and Kinetochore-associated protein NSL1 homolog (UniProt: Q9H081, Q6P1K2, Q9H410, Q96IY1, respectively)

RAN, a small GTP binding protein, belonging to the RAS superfamily is involved in the translocation of RNA and proteins through the nuclear pore complex and participate in the control of DNA synthesis and cell cycle progression. LPAC

RAN, a small GTP binding protein, belonging to the RAS superfamily is involved in the translocation of RNA and proteins through the nuclear pore complex and participate in the control of DNA synthesis and cell cycle progression. LPAC