Doxorubicin

Immunogen Recombinant protein corresponding to docking protein 2 Sequence RPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen Recombinant protein corresponding to docking protein 3 Sequence SPTTSPIYHNGQDLSWPGPANDSTLEAQYRRLLELDQVEGTGRPDPQAGFKAKLVTLLSRER Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen homeobox B8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

HOXD11 is a homeobox transcription factor that regulates morphogenesis. It is known to modulate metanephric kidney development in mouse embryos .

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including MSDS and any product information leaflets have been developed and issued under the Authority of the

Biochem/physiol Actions Doxercalciferol is a Vitamin D2 analogue, a Vitamin D Receptor Activator (VDRA). Doxercalciferol acts as a pro-hormone, needing 25-hydroxylation in the liver for bioactivation into 1&#945, 25-hydroxyvitamin D2.

Biochem/physiol Actions Doxercalciferol is a Vitamin D2 analogue, a Vitamin D Receptor Activator (VDRA). Doxercalciferol acts as a pro-hormone, needing 25-hydroxylation in the liver for bioactivation into 1&#945, 25-hydroxyvitamin D2.

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including MSDS and any product information leaflets have been developed and issued under the Authority of the

Phosphorescent host material. Polymer for use in electron transport layer in OPV and OLED applications.