Etisomicin

Albumins are a group of simple proteins found in the body fluids and tissues of animals and in some plant seeds. Unlike globulins, albumins have low molecular weights, are soluble in water, are easily crystallized and contain an excess of acidic

Immunogen Recombinant protein corresponding to ADAM metallopeptidase domain 11 Sequence LPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

A disintegrin and metallopeptidase domain 17 (ADAM17) belongs to ADAM family of genes, which has a characteristic cysteine rich region called disintegrin and a metalloproteinase domain. This gene is located on chromosome 2, spans 55kb and has 9

Analysis Note Purity (GC): &#8805 99.0 % Identity (IR): conforms Appearance: clear Colour: &#8804 10 Hazen Titrable acid: &#8804 0.

Analysis Note Purity (GC): &#8805 99.0 % Identity (IR): conforms Appearance: clear Colour: &#8804 10 Hazen Titrable acid: &#8804 0.

Analysis Note Purity (GC): &#8805 99.0 % Identity (IR): conforms Appearance: clear Colour: &#8804 10 Hazen Titrable acid: &#8804 0.