Fidaxomicin

Digoxigenin is a hapten, useful in labeling nucleic acids and in detection systems. Probes labeled with digoxigenin has greater sensitivity equivalent to that of radioactive probes, allows faster detection.

Immunogen Recombinant protein corresponding to dynein axonemal assembly factor 1 Sequence SLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Specificity The antibody binds specifically to phage coat proteins of fd phage or M13 phage and thus may act as a capture antibody when coated directly on multiwell plates or as a primary detection antibody for specifically captured fd or M13

Specificity The antibody binds specifically to phage coat proteins of fd phage or M13 phage and thus may act as a capture antibody when coated directly on multiwell plates or as a primary detection antibody for specifically captured fd or M13

Specificity Filamin B Immunogen Synthetic peptide from human filamin B. The immunogen peptide corresponds to a sequence near the hinge 2 region of Filamin B (near C-term) and is not present in the two C-terminally truncated splice variants of

Immunogen four jointed box 1 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

The gene FRMD7 (FERM domain containing 7) is mapped to human chromosome Xq27. The encoded FERM-domain containing protein is found to be expressed in the ventricular layer of the forebrain, midbrain, cerebellar primordium, spinal cord and the

Anti-FXYD7 FXYD domain containing ion transport regulator 7,

Interferon regulatory factor 7 (IRF7) is a member of the IRF family and has 1 IRF tryptophan pentad repeat DNA-binding domain. IRF7 is key transcriptional regulator of type I interferon (IFN)-dependent immune responses and regulates the

Immunogen PHD finger protein 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen PHD finger protein 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Biotin is a water-soluble vitamin which functions as a coenzyme for carboxylases. Biotin-16-dUTP is used to produce biotinylated DNA probes that are commonly used to detect specific DNA and RNA sequences in different methods like Southern and