Glycopeptides

Biochem/physiol Actions Alanyl dipeptides such as ala-leu, ala-lys, ala-gly, ala-pro, ala-tyr and ala-phe may be used in physicochemical studies or to evaluate dipeptide separation technologies. Alanyl dipeptides may also be used for studying cell

Biochem/physiol Actions Alanyl dipeptides such as ala-leu, ala-lys, ala-gly, ala-pro, ala-tyr and ala-phe may be used in physicochemical studies or to evaluate dipeptide separation technologies. Alanyl dipeptides may also be used for studying cell

The gene G3BP2 (GAP SH3 domain-binding protein-2) has been mapped to human chromosome 4q21.1.

The gene GDAP1 (ganglioside induced differentiation associated protein 1) encodes a protein that is most abundantly expressed in neurons and to some extent in Schwann cells. It is found to be localized to mitochondria and contains two C-terminal

Immunogen Recombinant protein corresponding to G kinase anchoring protein 1 Sequence QKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLEYEEHKKEYEDAENTSTQSKVMNK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Glypican-1 (UniProt: P35053 also known as GPC1, HSPG M12) is encoded by the Gpc1 gene (GeneID: 58920) in rat. Glypican-1 is attaches to the plasma membrane via glycosylphosphatidylinositol (GPI) anchors.

Anti-PAG1 phosphoprotein membrane anchor with glycosphingoli

Anti-PAG1 phosphoprotein membrane anchor with glycosphingoli

Amino Acid Sequence Met-Ala-Ile-Pro-Pro-Lys-Lys-Asn-Gln-Asp-Lys Biochem/physiol Actions The soluble carboxyl-terminal moiety of &#954-casein. This antithrombotic peptide binds to glycoprotein GPIb in the platelet membrane, thus inhibiting platelet

GDS Positive Control for Listeria is used with GDS Listeria Tq assays, which are automated nucleic acid amplification systems for the detection of Listeria in food and environmental samples. Application GDS Positive Control for Listeria is used for

Gly-Ala

Amino Acid Sequence Gly-Arg-Gly-Asp-Ser General description Gly-Arg-Gly-Asp-Ser peptide sequence is identical to the cell-binding region of fibronectin protein. Arg-Gly-Asp (RGD) region is found in various proteins, and is crucial for facilitating