-
Add to Cart The item has been added1165215-25MG1-O-ACETYL-3 5-DI-O-(4-CHLOROBENZOYL)-2?�-DEOXY-D-RIBOFURANOSE
Price: $2,307.69List Price: $2,564.10This Certified Reference Material (CRM) is produced and certified in accordance with ISO 17034 and ISO/IEC 17025. All information regarding the use of this CRM can be found on the certificate of analysis. -
Add to Cart The item has been added66807-10MG4,5-Methylenedioxy-1,2-phenylenediamine dihydrochloride (C15-1283-862)
Price: $315.00List Price: $350.004,5-Methylenedioxy-1,2-phenylenediamine dihydrochloride is a fluorescence tag for âº-keto acids. It is also required for the derivatization of sialic acids in presence of dilute sulfuric acid. -
Add to Cart The item has been added66807-50MG4,5-Methylenedioxy-1,2-phenylenediamine dihydrochloride (C15-1283-863)
Price: $809.14List Price: $899.054,5-Methylenedioxy-1,2-phenylenediamine dihydrochloride is a fluorescence tag for âº-keto acids. It is also required for the derivatization of sialic acids in presence of dilute sulfuric acid. -
Add to Cart The item has been addedD4784-100MG4,5-Methylenedioxy-1,2-phenylenediamine dihydrochloride (C15-1283-864)
Price: $935.45List Price: $1,039.394,5-Methylenedioxy-1,2-phenylenediamine dihydrochloride is a fluorescence tag for α keto acids. It is also required for the derivatization of sialic acids in presence of dilute sulfuric acid. -
Add to Cart The item has been addedD4784-10MG4,5-Methylenedioxy-1,2-phenylenediamine dihydrochloride (C15-1283-865)
Price: $244.29List Price: $271.434,5-Methylenedioxy-1,2-phenylenediamine dihydrochloride is a fluorescence tag for α keto acids. It is also required for the derivatization of sialic acids in presence of dilute sulfuric acid. -
Add to Cart The item has been addedD4784-50MG4,5-Methylenedioxy-1,2-phenylenediamine dihydrochloride (C15-1283-866)
Price: $543.29List Price: $603.664,5-Methylenedioxy-1,2-phenylenediamine dihydrochloride is a fluorescence tag for α keto acids. It is also required for the derivatization of sialic acids in presence of dilute sulfuric acid. -
Add to Cart The item has been addedA7730-25MGA-331440 dihydrochloride (C15-1237-196)
Price: $966.86List Price: $1,074.29Biochem/physiol Actions A-331440 dihydrochloride is a non-imidazole H 3 histamine receptor antagonist. Presynaptic histamine H(3) receptors regulate release of histamine and other neurotransmitters, and histamine H(3) receptor antagonists enhance -
Add to Cart The item has been addedA7730-5MGA-331440 dihydrochloride (C15-1237-197)
Price: $354.49List Price: $393.88Biochem/physiol Actions A-331440 dihydrochloride is a non-imidazole H 3 histamine receptor antagonist. Presynaptic histamine H(3) receptors regulate release of histamine and other neurotransmitters, and histamine H(3) receptor antagonists enhance -
Add to Cart The item has been addedHPA061707-100ULAnti-CYB5R2
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to cytochrome b5 reductase 2 Sequence NQTEEDILVRKELEEIARTHPDQFNLWYTLDRPPIGWKYSSGFVTA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA048712-25Anti-TOMM5 translocase of outer mitochondrial membrane 5 hom (C08-0240-716)
Price: $718.81List Price: $798.67Anti-TOMM5 translocase of outer mitochondrial membrane 5 hom -
Add to Cart The item has been addedHPA048712-100Anti-TOMM5 translocase of outer mitochondrial membrane 5 hom (C08-0262-734)
Price: $957.50List Price: $1,063.89Anti-TOMM5 translocase of outer mitochondrial membrane 5 hom -
Add to Cart The item has been added178223-10MGAntipain, Dihydrochloride - CAS 37682-72-7 - Calbiochem
Price: $278.57List Price: $309.52A reversible protease inhibitor produced by actinomycetes. Inhibits cathepsin A and B as well as papain, and trypsin-like serine proteases.
