Hetacillin potassium

Application (+)-Potassium D s - threo -isocitrate monobasic may be used in the assessment of isocitrate dehydrogenase 2 (Idh2) activity by Kornberg method. Packaging Bottomless glass bottle.

Application (+)-Potassium D s - threo -isocitrate monobasic may be used in the assessment of isocitrate dehydrogenase 2 (Idh2) activity by Kornberg method. Packaging Bottomless glass bottle.

Cytoskeleton-associated protein 4 (CKAP4) also called as p63 is a 63kDa protein, which belongs to the family of type II transmembrane receptor. This membrane protein consists of NH2 terminus with 106-amino acid-long cytosolic tail and a

KCNA10 codes for a tetrameric protein that belongs to the potassium channel, voltage-gated (shaker-related) family. It is strongly expressed in hair cells of the inner ear in mice .

KCNAB3 codes for a member of potassium voltage-gated channel (shaker-related) protein subfamily. This protein is a &#946 subunit and can form heterodimers that modulate the function of &#945 subunits.

Immunogen Synthetic peptide directed towards the middle region of human KCNH6 Biochem/physiol Actions Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural

Immunogen Recombinant protein corresponding to potassium voltage-gated channel subfamily J member 10 Sequence EFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV Application All Prestige Antibodies Powered by Atlas Antibodies are

Anti-KCNK18 potassium channel, subfamily K, member 18, 100ul

Anti-KCNK18 potassium channel, subfamily K, member 18, 25ul

KLF8 functions as a downstream target of focal adhesion kinase (FAK) during cell cycle progression and cyclin D1 regulation . It has also been implicated in oncogenic transformation .

Kirsten rat sarcoma-2 virus oncogene (KRAS), also known as c-K-Ras, is encoded by the gene mapped to human chromosome 12p12.1.

Immunogen Keratin, type I cytoskeletal 23 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are